Skip to Content
MilliporeSigma
All Photos(5)

Key Documents

SAB1412311

Sigma-Aldrich

ANTI-HMGB2 antibody produced in mouse

clone 4G7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

HMG2, HMGB2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4G7, monoclonal

form

buffered aqueous solution

mol wt

antigen 47.19 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HMGB2(3148)

General description

High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein encoded by the HMGB2 gene in humans. The protein belongs to a family of chromatin proteins made up of two basic DNA binding domains, HMG box A and B, and a C-terminal acidic tail. The gene is mapped to human chromosome 4q34.

Immunogen

HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE

Biochem/physiol Actions

High-mobility group protein B2 (HMGB2) functions as a significant prognostic factor and may play a crucial role in cell invasion. The gene acts as a novel prognostic marker and an attractive therapeutic target for glioblastoma multiforme (GBM). The protein helps in altering DNA elasticity while facilitating transcription, replication and DNA repair. It plays a significant role in tumor development and during prognosis of hepatocellular carcinoma (HCC). It may also be associated with the anti-apoptotic pathway.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Circulating oxysterol metabolites as potential new surrogate markers in patients with hormone receptor-positive breast cancer: Results of the OXYTAM study.
Dalenc F
The Journal of Steroid Biochemistry and Molecular Biology, 169, 210-218 (2017)
Single-molecule kinetics reveal microscopic mechanism by which High-Mobility Group B proteins alter DNA flexibility.
McCauley MJ
Nucleic Acids Research, 41, 167-181 (2013)
High mobility group B2 is secreted by myeloid cells and has mitogenic and chemoattractant activities similar to high mobility group B1.
Pusterla T
Autoimmunity, 42, 308-310 (2009)
High-mobility group box 2 is associated with prognosis of glioblastoma by promoting cell viability, invasion, and chemotherapeutic resistance.
Wu ZB
Neuro-Oncology, 15, 1264-1275 (2013)
Overexpression of high-mobility group box 2 is associated with tumor aggressiveness and prognosis of hepatocellular carcinoma.
Kwon JH
CVD of Nonmetals, 16, 5511-5521 (2010)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service