Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

SAB1404503

Sigma-Aldrich

Monoclonal Anti-TYMS antibody produced in mouse

clone 2B2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

HsT422, MGC88736, TMS, TS, TSase

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2B2, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.11 kDa

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TYMS(7298)

General description

The gene encoding thymidylate synthetase (TYMS) is localized on human chromosome 18p11.32.

Immunogen

TYMS (AAH13919, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC

Biochem/physiol Actions

Thymidylate synthetase (TYMS) has a role in DNA replication and thymidylate biosynthesis. It is also involved in cell survival and proliferation. TYMS takes part in folate metabolism. The protein methylates deoxyuridylate to deoxythymidylate.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Digital karyotyping identifies thymidylate synthase amplification as a mechanism of resistance to 5-fluorouracil in metastatic colorectal cancer patients.
Wang T, et al
Proceedings of the National Academy of Sciences of the USA, 101(9), 3089-3094 (2004)
Higher Tissue Levels of Thymidylate Synthase Determined by ELISA Are Associated with Poor Prognosis of Patients with Lung Cancer.
Shiina T, et al.
The Tohoku Journal of Experimental Medicine, 242(4), 303-316 (2017)
Thymidylate synthase gene polymorphisms as important contributors affecting hepatocellular carcinoma prognosis.
Wang X, et al.
Clinics and Research in Hepatology and Gastroenterology, 4193), 319-326 (2017)
Thymidylate synthase polymorphisms and risk of lung cancer among the Jordanian population: a case control study.
Qasem W A, et al.
Asian Pacific Journal of Cancer Prevention, 16, 8287-8292 (2015)
Yongjun Cha et al.
Anticancer research, 34(8), 4275-4280 (2014-07-31)
To identify immunohistochemical (IHC) features associated with sensitivity to lapatinib-plus-capecitabine (LX) and resistance to trastuzumab in human epidermal growth factor receptor (HER)-2-positive metastatic breast cancer. Expression levels of estrogen receptor, progesterone receptor, epidermal growth factor receptor, HER2, HER3/phosphorylated HER3 (pHER3)

Articles

Neoplastic cells are highly dependent on the de novo synthesis of nucleotides to maintain sufficient pools to support DNA replication and the production of RNA.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service