Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

SAB1402233

Sigma-Aldrich

Monoclonal Anti-HSPA4 antibody produced in mouse

clone 3A11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

APG-2, HS24/P52, MGC131852, RY, hsp70, hsp70RY

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3A11, monoclonal

form

buffered aqueous solution

mol wt

antigen ~42.39 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HSPA4(3308)

Related Categories

Immunogen

HSPA4 (AAH02526, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID

Biochem/physiol Actions

Hspa4 (heat shock protein family A (Hsp70) member 4) is an important ATP-dependent cytosolic chaperone along with Hsp90. Hspa4 aids in the folding of several proteins and helps in protecting against cellular stresses such as rise in temperature. Hspa4 maintains the function of the mitotic centrosome to coordinates bipolar mitotic spindle assembly. Hspa4 might compensate the loss of parkin function in mice by protecting the cells against proteolytic and mitochondrial stress. Therefore, it can serve as an important therapeutic agent for parkinson disease. Upregulation of HSPA4 is observed in parkin gene knockout mice. Hspa4 is known to be associated with tumor progression and offers resistance against many therapeutic agents. The gene is upregulated in many different types of cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Cheng-Wu Zhang et al.
Neuro-degenerative diseases, 16(5-6), 304-316 (2016-02-18)
Mutations of parkin are a prevalent genetic contributor to familial Parkinson's disease (PD). As a key regulator of protein and mitochondrial homeostasis, parkin plays a pivotal role in maintaining dopaminergic neuronal survival. However, whereas Drosophila parkin null mutants exhibit prominent
Chieh-Ting Fang et al.
Cellular and molecular life sciences : CMLS, 73(20), 3949-3960 (2016-05-04)
To establish a functional bipolar mitotic spindle, the centrosome expands and matures, acquiring enhanced activities for microtubule (MT) nucleation and assembly at the onset of mitosis. However, the regulatory mechanisms of centrosome maturation and MT assembly from the matured centrosome
Tomohiko Harada et al.
Pancreatology : official journal of the International Association of Pancreatology (IAP) ... [et al.], 9(1-2), 13-24 (2008-12-17)
Microarray-based comparative genomic hybridisation (CGH) has allowed high-resolution analysis of DNA copy number alterations across the entire cancer genome. Recent advances in bioinformatics tools enable us to perform a robust and highly sensitive analysis of array CGH data and facilitate
Induction of Hsp70 in tumor cells treated with inhibitors of the Hsp90 activity: A predictive marker and promising target for radiosensitization.
Kudryavtsev VA, et.al.
PLoS ONE, 12(3), 1-25 (2017)
Vladimir A Kudryavtsev et al.
PloS one, 12(3), e0173640-e0173640 (2017-03-16)
We studied a role of the inducible heat shock protein 70 (Hsp70) in cellular response to radiosensitizing treatments with inhibitors of the heat shock protein 90 (Hsp90) chaperone activity. Cell lines derived from solid tumors of different origin were treated

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service