SAB1400121

Monoclonal Anti-HDAC1 antibody produced in mouse

clone 5C11, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-DKFZp686H12203, Anti-GON10, Anti-HD1, Anti-RPD3, Anti-RPD3L1
• MDL number: MFCD01633420
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 5C11, monoclonal
• form: buffered aqueous solution
• species reactivity: human, rat, mouse
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• UniProt accession no.: Q13547
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HDAC1(3065)

Description

General description

Histone deacetylase 1 (HDAC1) is mainly expressed in the nucleus. It belongs to class I of histone deacetylases and the gene encoding it is localized on human chromosome 1p35.2.

Immunogen

HDAC1 (AAH00301, 1 a.a. ~ 482 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Biochem/physiol Actions

Histone deacetylase 1 (HDAC1) is an epigenetic factor. It is part of the innate antiviral response. The protein has roles in DNA repair, splicing, regulation of gene expression and cell division. It deacetylates lysine residues of histone H3 and H4. HDAC1 has been shown to have a role in various cancers.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable