Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

MSST0034

Sigma-Aldrich

SILuLite COL1A1 N-terminal propeptide human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonym(s):

Collagen alpha-1(I) chain, Collagenalpha-1(I)chain, P1NP

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352200

biological source

human

Quality Level

recombinant

expressed in HEK 293 cells

Assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≥98% Heavy amino acids incorporation efficiency by MS

technique(s)

mass spectrometry (MS): suitable

suitability

suitable for mass spectrometry (internal calibrator)

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... COL1A1(1277)

Related Categories

General description

Collagen type I is present in soft connective tissues and bone, where it constitutes more than 90% of the organic matrix.1 During bone formation collagen type I is synthesized from pro-collagen type I, which is secreted from fibroblasts and osteoblasts.2 Pro-collagen type I contains N-and C-terminal extensions, which are removed by specific proteases during the conversion of procollagen to collagen.3 Measurements of N- terminal propeptides of procollagen type I (PINP) can be of value in assessing bone formation. Recent evidence indicates that PINP can serve as a serum biomarker of bone formation, as it accurately identifies those patients who are responding to anabolic or antiresorptive therapy within 3 months of the start of treatment.4 The use of this biomarker in patients being treated for osteoporosis may significantly improve therapy adherence and clinical outcomes.4

Immunogen

QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPDYKDDDDKGHHHHHHHHGGQ

Biochem/physiol Actions

SILuLite COL1A1 recombinant human protein expressed in human 293 cells. It is a protein of 159 amino acids (Q23-P161 and including C-terminal polyhistidine and FLAG® tags) with a calculated molecular mass of 16 kDa. SILu Lite COL1A1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Physical form

Lyophilized from a solution of phosphate buffered saline.

Legal Information

FLAG is a registered trademark of Merck KGaA, Darmstadt, Germany
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service