Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

MSST0005

Sigma-Aldrich

SILuProt VEGFA Vascular endothelial growth factor A human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled

Synonym(s):

SILuProt Vascular endothelial growth factor A

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
23201100
NACRES:
NA.12

biological source

human

Quality Level

recombinant

expressed in HEK 293 cells

Assay

≥95% (SDS-PAGE)

form

lyophilized powder

technique(s)

mass spectrometry (MS): suitable

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... VEGFA(7422)

Related Categories

General description

SILu Prot VEGF165 is a recombinant, stable isotope-labeled human VEGF165 which incorporates [13C6,15N4]−Arginine and [13C6, 15N2]−Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of VEGF165 by mass-spectrometry.

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Biochem/physiol Actions

VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure1. VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration2.
VEGF has also been implicated in correlation with poor prognosis in breast cancer2. In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4.

Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice),1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service