Skip to Content
MilliporeSigma
All Photos(6)

Key Documents

HPA023938

Sigma-Aldrich

Anti-DEPTOR antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(s):

Anti-DEP domain-containing protein 6, Anti-DEPDC6

Sign Into View Organizational & Contract Pricing
All Photos(6)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA023938
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

LVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEH

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DEPDC6(64798)

General description

DEPTOR (DEP domain containing MTOR-interacting protein) is a tumor suppressor and mTOR-binding protein. This protein is expressed in vascular endothelial cells.

Immunogen

DEP domain-containing protein 6 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

DEPTOR (DEP domain containing MTOR-interacting protein) suppresses mTORC1(mammalian target of rapamycin complex 1) and mTORC2 proteins which are responsible for the control of cell growth, metabolism, proliferation and survival. It is expressed in normal pancreatic acinar and islet cells, and this expression is completely lost in pancreatic ductal adenocarcinoma (PDAC) tissues. Therefore, it functions as a tumor suppressor in pancreatic cancer. It is regulator of inflammatory and angiogenic responses and controls the activation of vascular endothelial cells. DEPTOR is expressed in placenta, and DEPTOR signaling is influenced by maternal stress which might eventually impact the outcome of pregnancy. The expression of this protein is reduced in thyroid, prostate, bladder and cervical cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76297

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Placental DEPTOR as a stress sensor during pregnancy.
Mparmpakas D et al
Clinical Science (London, England : 1979), 122(7), 349-359 (2012)
DEPTOR has growth suppression activity against pancreatic cancer cells.
Li H et al
Oncotarget, 5(24), 12811-12819 (2014)
DEPTOR regulates vascular endothelial cell activation and proinflammatory and angiogenic responses.
Bruneau S et al
Blood, 122(10), 1833-1842 (2013)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service