Skip to Content
MilliporeSigma
All Photos(9)

Key Documents

HPA009300

Sigma-Aldrich

Anti-CD93 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-C1QR antibody produced in rabbit, Anti-C1q/MBL/SPA receptor, Anti-C1qR, Anti-C1qR(p), Anti-C1qRp, Anti-CD93 antigen, Anti-CDw93, Anti-Complement component 1 q subcomponent receptor 1, Anti-Complement component C1q receptor precursor, Anti-Matrix-remodeling-associated protein 4

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

FNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSSGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CD93(22918)

General description

CD93 (cluster of differentiation 93) is a cell surface receptor for heat-sensitive complement factor C1q, and hence, is also called C1qR. This protein shows major expression on endothelial cells. In neonatal umbilical cord blood cells (UCBCs) this protein is co-expressed on naive T-lymphocytes (CD4+ CD45RA+ cells). However, this protein is absent in adult peripheral blood cells (PBCs). It is a heavily O-glycosylated type I transmembrane protein. Its predominant expression is on endothelial cells, monocytes, granulocytes, and immature hematopoietic progenitor cells (CD34+ hematopoietic stem cells). It has a molecular weight of 90-100kDa. In soluble form it is found in human plasma.

Immunogen

Complement component C1q receptor precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Complement factor C1q links the human parvovirus B19 (B19V) to its receptor CD93 (cluster of differentiation 93), which results in the entry of B19V through endocytosis. The expression of CD93 is controlled by PKCδ (protein kinase C) isozyme. During multiple immune responses, this protein is essential for the removal or exclusion of apoptotic cells. It controls immune responses in both adults and neonates. Single nucleotide polymorphisms (SNPs) rs3746731, Pro541Ser in this gene are linked with risk of coronary artery disease (CAD). Plasma levels of this protein can be a potential biomarker for CADs, which includes myocardial infarction (MI).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71888

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nobunao Ikewaki et al.
Microbiology and immunology, 57(12), 822-832 (2013-09-17)
It has previously been reported by these authors that cluster of differentiation (CD) 93 is co-expressed on naive T-lymphocytes (CD4(+) CD45RA(+) cells) in neonatal umbilical cord blood cells (UCBCs) but not on normal adult peripheral blood cells (PBCs). In this
Stéphane Chevrier et al.
Proceedings of the National Academy of Sciences of the United States of America, 106(10), 3895-3900 (2009-02-21)
Plasma cells represent the end stage of B-cell development and play a key role in providing an efficient antibody response, but they are also involved in numerous pathologies. Here we show that CD93, a receptor expressed during early B-cell development
Yi Sun et al.
Science translational medicine, 13(604) (2021-07-30)
The immature and dysfunctional vascular network within solid tumors poses a substantial obstacle to immunotherapy because it creates a hypoxic tumor microenvironment that actively limits immune cell infiltration. The molecular basis underpinning this vascular dysfunction is not fully understood. Using
A Mälarstig et al.
Journal of internal medicine, 270(3), 229-236 (2011-02-22)
A common nonsynonymous single nucleotide polymorphism (SNP) in the CD93 gene (rs3746731, Pro541Ser) has been associated with risk of coronary artery disease (CAD). CD93 is a transmembrane glycoprotein, which is detectable in soluble form in human plasma. We investigated whether
Nobunao Ikewaki et al.
Journal of clinical immunology, 30(5), 723-733 (2010-06-01)
Human CD93 has a molecular weight of about 100 kDa and is selectively expressed by myeloid cell lineages in peripheral blood (PB) mononuclear cells. Although CD93 was initially identified as a receptor for complement component 1, subcomponent q phagocytosis (C1qRp) involved

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service