Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

HPA007179

Sigma-Aldrich

Anti-PTPRN antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ICA 512 antibody produced in rabbit, Anti-Islet cell antigen 512 antibody produced in rabbit, Anti-Islet cell autoantigen 3 antibody produced in rabbit, Anti-PTP IA-2 antibody produced in rabbit, Anti-R-PTP-N antibody produced in rabbit, Anti-Receptor-type tyrosine-protein phosphatase-like N precursor antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PTPRN(5798)

General description

The insulinoma associated protein tyrosine phosphatase 2 (IA-2)/ PTPRN is a transmembrane glycoprotein of 106 kDa. Its expression is seen in neuroendocrine cells. IA-2 is a member of the protein tyrosine phosphatase (PTP) family. It has three domains, such as the extracellular domain, intracellular domain and a single transmembrane domain. This gene is mapped to human chromosome 2q35.

Immunogen

Receptor-type tyrosine-protein phosphatase-like N precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-PTPRN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PTPRN (Protein tyrosine phosphatase, receptor type, N) is involved in the neuroendocrine secretory processes such as biogenesis, trafficking or regulated exocytosis. A study shows that PTPRN is associated with the type 1 diabetes development.
The insulinoma associated protein tyrosine phosphatase 2 (IA-2)/PTPRN is an immunodominant autoantigen, that participates in the autoimmune attack to the β-cell in type 1 diabetes mellitus. It plays a key role in the cytoplasmic transport of dense core secretory granules (DSG) in pancreatic islets.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70124

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Assignment of the human gene for receptor-type protein tyrosine phosphatase IA-2 (PTPRN) to chromosome region 2q35-q36.1 and identification of an intragenic genetic marker
van den MAMJM, et al.
Cytogenetic and genome research, 73(1-2), 145-148 (1996)
William J Giardino et al.
Frontiers in neuroanatomy, 6, 5-5 (2012-02-22)
Detailed examination of the midbrain Edinger-Westphal (EW) nucleus revealed the existence of two distinct nuclei. One population of EW preganglionic (EWpg) neurons was found to control oculomotor functions, and a separate population of EW centrally projecting (EWcp) neurons was found
Novel prokaryotic expression of thioredoxin-fused insulinoma associated protein tyrosine phosphatase 2 (IA-2), its characterization and immunodiagnostic application
Guerra LL, et al.
BMC biotechnology, 16, 84-84 (2016)
M Solimena et al.
The EMBO journal, 15(9), 2102-2114 (1996-05-01)
Islet cell autoantigen (ICA) 512 is a novel autoantigen of insulin-dependent diabetes mellitus (IDDM) which is homologous to receptor-type protein tyrosine phosphatases (++PTPases). We show that ICA 512 is an intrinsic membrane protein of secretory granules expressed in insulin-producing pancreatic
Stephanie Krause et al.
Clinical immunology (Orlando, Fla.), 145(3), 224-229 (2012-11-01)
Autoantibodies to insulinoma-associated protein 2 (IA-2A) are associated with increased risk for type 1 diabetes. Here we examined IA-2A affinity and epitope specificity to assess heterogeneity in response intensity in relation to pathogenesis and diabetes risk in 50 children who

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service