Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV49131

Sigma-Aldrich

Anti-FTSJ1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CDLIV, Anti-FtsJ homolog 1 (E. coli), Anti-JM23, Anti-MRX44, Anti-MRX9, Anti-SPB1, Anti-TRM7

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

36 kDa

species reactivity

horse, rabbit, rat, pig, human, mouse, bovine, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FTSJ1(24140)

Immunogen

Synthetic peptide directed towards the N terminal region of human FTSJ1

Application

Anti-FTSJ1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

FtsJ RNA methyltransferase homolog 1 (E. coli) is a methyltransferase that localizes to the nucleolus and binds to S-adenosylmethionine and mediates rRNA processing. Mutations in the gene encoding this enzyme results in nonsyndromic X-linked mental retardation.

Sequence

Synthetic peptide located within the following region: MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

J Ramser et al.
Journal of medical genetics, 41(9), 679-683 (2004-09-03)
Mental retardation is the most frequent cause of serious handicap in children and young adults. The underlying causes of this heterogeneous condition are both acquired and genetically based. A recently performed refinement of the linkage interval in a large Belgian
Kristine Freude et al.
American journal of human genetics, 75(2), 305-309 (2004-05-27)
Nonsyndromic X-linked mental retardation (NSXLMR) is a very heterogeneous condition, and most of the underlying gene defects are still unknown. Recently, we have shown that approximately 30% of these genes cluster on the proximal Xp, which prompted us to perform
Carole Trzaska et al.
Nature communications, 11(1), 1509-1509 (2020-03-22)
Nonsense mutations cause about 10% of genetic disease cases, and no treatments are available. Nonsense mutations can be corrected by molecules with nonsense mutation readthrough activity. An extract of the mushroom Lepista inversa has recently shown high-efficiency correction of UGA

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service