Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV48684

Sigma-Aldrich

Anti-MAP3K1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-MAPKKK1, Anti-MEKK, Anti-MEKK1, Anti-Mitogen-activated protein kinase kinase kinase 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

164 kDa

species reactivity

rabbit, guinea pig, rat, mouse, bovine, horse, human, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MAP3K1(4214)

Related Categories

General description

Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin (MAP3K1) is a serine/threonine kinase that regulates cell signaling. It interacts with Axin1 and is involved in Wnt signaling. Genetic variations in MAP3K1 have been linked to breast cancer risk and sex development disorders.
Rabbit Anti-MAP3K1 antibody recognizes human, mouse, rat, bovine, and rabbit MAP3K1.

Immunogen

Synthetic peptide directed towards the C terminal region of human MAP3K1

Application

Rabbit Anti-MAP3K1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-983 AC008937.7 118022-119004 c 984-1536 AF042838.1 426-978 1537-1653 AC008937.7 68621-68737 c 1654-1802 AC008937.7 68100-68248 c 1803-2870 AF042838.1 1245-2312 2871-4167 AC008937.7 51211-52507 c 4168-4758 BU194120.1 127-717 4759-5154 DA889202.1 164-559 5155-7355 AC008937.7 38082-40282 c 7356-7522 AA602425.1 1-167 c

Sequence

Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Alexander Pearlman et al.
American journal of human genetics, 87(6), 898-904 (2010-12-07)
Investigations of humans with disorders of sex development (DSDs) resulted in the discovery of many of the now-known mammalian sex-determining genes, including SRY, RSPO1, SOX9, NR5A1, WT1, NR0B1, and WNT4. Here, the locus for an autosomal sex-determining gene was mapped
Lilian Jara et al.
Breast cancer research and treatment, 137(2), 559-569 (2012-12-12)
Genome-Wide Association Studies have identified several loci associated with breast cancer (BC) in populations of different ethnic origins. One of the strongest associations was found in the FGFR2 gene, and MAP3K1 has been proposed as a low-penetrance BC risk factor.
Ser Sue Ng et al.
Biological chemistry, 391(2-3), 171-180 (2010-02-05)
A central point of regulation in the Wnt/beta-catenin signalling pathway is the formation of the beta-catenin destruction complex. Axin1, an essential negative regulator of Wnt signalling, serves as a scaffold within this complex and is critical for rapid turnover of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service