Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV45607

Sigma-Aldrich

Anti-RORA antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-MGC119326, Anti-MGC119329, Anti-NR1F1, Anti-RAR-related orphan receptor A, Anti-ROR1, Anti-ROR2, Anti-ROR3, Anti-RZRA

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

62 kDa

species reactivity

horse, pig, rabbit, dog, goat, human, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RORA(6095)

Immunogen

Synthetic peptide directed towards the middle region of human RORA

Application

Anti-RORA antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Biochem/physiol Actions

Retinoic acid related orphan receptor A (RORA), a member of the retinoid-related orphan family of nuclear receptors, is a ligand-dependent transcription factor. RORA is widely expressed and enhances p53-dependent apoptosis. RORA is important for the development of the cerebellum and it is required for the maturation of photoreceptors in the retina.

Sequence

Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

David A Gold et al.
Brain research, 1140, 19-25 (2006-01-24)
The staggerer mutation was first identified at the Jackson Laboratory in 1955. In the ensuing half-century, studies of staggerer mice have provided new insights into developmental neurobiology, gene regulatory networks, and circadian behavior. Recent work has expanded the role of
Huilin Zhang et al.
Scientific reports, 4, 5811-5811 (2014-07-25)
The receptor-tyrosine-kinase-like orphan receptor 1 (ROR1) is a transmembrane protein belongs to receptor tyrosine kinase (RTK) family. This study aimed to examine the expression of ROR1 in human ovarian cancer and investigate the relationship between its expression and the prognosis

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service