Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV34704

Sigma-Aldrich

Anti-ZMyND11 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-BRAM1, Anti-BS69, Anti-MGC111056, Anti-RP11-486H9.1, Anti-Zinc finger, MyND domain containing 11

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

42 kDa

species reactivity

human, rat, horse, guinea pig, bovine, dog, rabbit, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZMYND11(10771)

General description

ZMyND11 is a zinc-finger protein that links H3, 3K36me3 to tumor suppression and transcriptional elongation. ZMyND11 has also been implicated in poorly differentiated myeloid leukemia.
Rabbit Anti-ZMyND11 antibody recognizes bovine, chicken, human, mouse, rat, and canine ZMyND11.

Immunogen

Synthetic peptide directed towards the middle region of human ZMYND11

Application

Rabbit Anti-ZMyND11 (AB1) antibody is suitable for western blot (2.5 μg/ml) and IHC (4-8 μg/ml) assays.

Biochem/physiol Actions

ZMYND11 was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression.

Sequence

Synthetic peptide located within the following region: SMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Recurrent translocation (10;17)(p15;q21) in acute poorly differentiated myeloid leukemia likely results in ZMYND11-MBTD1 fusion.
Etienne De Braekeleer et al.
Leukemia & lymphoma, 55(5), 1189-1190 (2013-08-07)
Santanu Adhikary et al.
The Journal of biological chemistry, 291(6), 2664-2681 (2015-12-15)
ZMYND8 (zinc finger MYND (Myeloid, Nervy and DEAF-1)-type containing 8), a newly identified component of the transcriptional coregulator network, was found to interact with the Nucleosome Remodeling and Deacetylase (NuRD) complex. Previous reports have shown that ZMYND8 is instrumental in
Hong Wen et al.
Nature, 508(7495), 263-268 (2014-03-05)
Recognition of modified histones by 'reader' proteins plays a critical role in the regulation of chromatin. H3K36 trimethylation (H3K36me3) is deposited onto the nucleosomes in the transcribed regions after RNA polymerase II elongation. In yeast, this mark in turn recruits

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service