Skip to Content
MilliporeSigma
All Photos(9)

Key Documents

AMAB91116

Sigma-Aldrich

Monoclonal Anti-SLC6A2 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL3063, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):

NAT1, NET1, SLC6A2, SLC6A5

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL3063, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, rat, mouse

technique(s)

immunohistochemistry: 1:200-1:500

isotype

IgG1

immunogen sequence

SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NET(6530)

General description

Sodium-dependent noradrenaline transporter (NET) is also called solute carrier family 6 member 2 (SLC6A2). The SLC6A2 gene is mapped to locus 16q12.2 in the human chromosome. The sodium-dependent noradrenaline transporter (NET) belongs to sodium and chloride-dependent neurotransmitter transporter family and is a glycosylated protein.

Immunogen

Solute carrier family 6 member 2

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Regulation of noradrenalin transport is the primary function of the norepinephrine transporter (NET).It is crucial for neuronal function and regulates neurotransmitter uptake in the central nervous system. Polymorphisms in NET gene is implicated in attention-deficit/hyperactivity disorder (ADHD). Mutations in NET impacts the transport functionality resulting in orthostatic intolerance disorder. Polymorphisms of SLC6A2 impacts neurotransmission in patients with major depressive disorder.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86859

Physical form

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Alleviating transcriptional inhibition of the norepinephrine slc6a2 transporter gene in depolarized neurons
Harikrishnan KN, et al.
The Journal of Neuroscience, 30(4), 1494-1501 (2010)
Monoamine transporter gene polymorphisms affect susceptibility to depression and predict antidepressant response
Min W, et al.
Psychopharmacology, 205(3), 409-417 (2009)
A mutation in the human norepinephrine transporter gene (SLC6A2) associated with orthostatic intolerance disrupts surface expression of mutant and wild-type transporters
Hahn MK, et al.
The Journal of Neuroscience, 23(11), 4470-4478 (2003)
Differential association between the norepinephrine transporter gene and ADHD: role of sex and subtype
Sengupta SN, et al.
Journal of Psychiatry & Neuroscience, 37(2), 129-129 (2012)
Association between norepinephrine transporter gene (SLC6A2) polymorphisms and suicide in patients with major depressive disorder
Kim YK, et al.
Journal of Affective Disorders, 158, 127-132 (2014)

Global Trade Item Number

SKUGTIN
AMAB91116-100UL4061837049316
AMAB91116-25UL4061841323020

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service