AV42146
Anti-PPAP2A (AB1) antibody produced in rabbit
IgG fraction of antiserum
Sinônimo(s):
Anti-LLP1a, Anti-LPP1, Anti-PAPα1, Anti-PAP-2a, Anti-PAP2, Anti-PAP2a2, Anti-PAP2alpha2, Anti-Phosphatidic acid phosphatase type 2A
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
IgG fraction of antiserum
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous solution
peso molecular
31 kDa
reatividade de espécies
rat, mouse, bovine, human, dog, guinea pig, horse, rabbit
concentração
0.5 mg - 1 mg/mL
técnica(s)
immunohistochemistry: suitable
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... PPAP2A(8611)
Descrição geral
Lipid phosphate phosphatases (LPP) dephosphorylate a variety of bioactive lipids including phosphatidate, lysophosphatidate, sphingosine 1-phosphate, and ceramide 1-phosphate.
The lipid phosphate phosphatase phosphatidic acid phosphatase type 2A/lipid phosphate phosphohydrolase type 1(PPAP2A, LLP1) dephosphorylates exogenous lysophosphatidate (LPA), a lipid mediator that stimulates cell proliferation and growth, and is involved in physiological and pathological processes such as wound healing, platelet activation, angiogenesis and the growth of tumours.
The lipid phosphate phosphatase phosphatidic acid phosphatase type 2A/lipid phosphate phosphohydrolase type 1(PPAP2A, LLP1) dephosphorylates exogenous lysophosphatidate (LPA), a lipid mediator that stimulates cell proliferation and growth, and is involved in physiological and pathological processes such as wound healing, platelet activation, angiogenesis and the growth of tumours.
Especificidade
Anti-PPAP2A (AB1) polyclonal antibody reacts with human, zebrafish, mouse, rat, chicken, bovine, pig, and rabbit phosphatidic acid phosphatase type 2A proteins.
Imunogênio
Synthetic peptide directed towards the middle region of human PPAP2A
Aplicação
Anti-PPAP2A (AB1) polyclonal antibody is used to tag phosphatidic acid phosphatase type 2A for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of phosphatidic acid phosphatase type 2A as an integral membrane bioactive lipid phosphatase.
Ações bioquímicas/fisiológicas
PPAP2A is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space. The expression of PPAP2A is found to be regulated by androgen in a prostatic adenocarcinoma cell line.The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space. The expression of this gene is found to be regulated by androgen in a prostatic adenocarcinoma cell line. At least two alternatively spliced transcript variants encoding distinct isoforms have been described.
Sequência
Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Ishita Chatterjee et al.
Cardiovascular research, 111(1), 105-118 (2016-04-30)
Lipid phosphate phosphatase-3 (LPP3) is expressed at high levels in endothelial cells (ECs). Although LPP3 is known to hydrolyse the phosphate group from lysolipids such as spingosine-1-phosphate and its structural homologues, the function of Lpp3 in ECs is not completely
J Aranda et al.
Diabetologia, 56(6), 1444-1453 (2013-03-20)
The realisation that targeting agents in the vitreous is an effective approach to treating patients with diabetic retinopathy (DR) has increased awareness that changes in the composition/bioactivity of the vitreous is a contributor to the pathogenesis of DR. The overall
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica