HPA031531
Anti-CAPZB antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-CD85k, Anti-HM18, Anti-ILT3, Anti-LIR-5, Anti-capping protein (actin filament) muscle Z-line, β
Sign Into View Organizational & Contract Pricing
All Photos(7)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
mouse, human, rat
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CAPZB(832)
General description
CAPZB (capping actin protein of muscle Z-line β subunit) gene is mapped to human chromosome 1p36.13. It is widely expressed in pharyngeal arch, and also in lymphoid cells, seminiferous ducts, urothelium and placenta. The gene codes for β-subunit of the barbed-end F-actin-binding protein.
Immunogen
capping protein (actin filament) muscle Z-line, beta recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CAPZB antibody produced in rabbit has been used in immunoblotting and immunofluorescence procedures.
Biochem/physiol Actions
CAPZB (capping actin protein of muscle Z-line βsubunit) is a heterodimeric protein that caps the growing end of F-actin. This actin-capping protein facilitates the joining of actin filaments to the Z-line of the sarcomere in muscles, thereby modulating the cytoskeleton. The protein regulates actin filament dynamics by blocking actin filament assembly and disassembly, and thereby, modulating cell shape and movement in vitro. It is known to promote cell motility by increasing the depolymerization and capping of actin filaments. CAPZB is associated with tumor progression in cases of epithelioid sarcoma.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST76535
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Purification and characterization of an alpha 1 beta 2 isoform of CapZ from human erythrocytes: cytosolic location and inability to bind to Mg2+ ghosts suggest that erythrocyte actin filaments are capped by adducin.
Biochemistry, 36(44), 13461-13472 (1997)
Actin capping proteins, CapZ (?-actinin) and tropomodulin in amphioxus striated muscle.
Bao Y
Gene, 510(1), 78-86 (2012)
Meta-analysis of two genome-wide association studies identifies four genetic loci associated with thyroid function.
Rawal R
Human Molecular Genetics, 21(14), 3275-3282 (2012)
Actin capping protein CAPZB regulates cell morphology, differentiation, and neural crest migration in craniofacial morphogenesis?.
Mukherjee K
Human Molecular Genetics, 25(7), 1255-1270 (2016)
Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
Zhan M
Human Molecular Genetics, 23(20), 5505-5517 (2014)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service