HPA018433

Anti-CBR1 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-15-Hydroxyprostaglandin dehydrogenase [NADP+], Anti-Carbonyl reductase [NADPH] 1, Anti-NADPH-dependent carbonyl reductase 1, Anti-Prostaglandin 9-ketoreductase, Anti-Prostaglandin-E(2) 9-reductase
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA018433
• NACRES: NA.43

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• immunogen sequence: TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE
• UniProt accession no.: P16152
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CBR1(873)

Description

General description

The gene CBR1 (carbonyl reductase [NADPH] 1) is mapped to human chromosome 21q22.13. CBR1 is a ubiquitously-expressed protein. The protein localizes in the cytoplasm and is monomeric in nature. CBR1 is abundantly present in amnion epithelial, fibroblast cells and chorionic trophoblast cells.

Immunogen

Carbonyl reductase [NADPH] 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

Carbonyl reductase [NADPH] 1 (CBR1) is an NADPH-dependent dehydrogenase/reductase and is responsible for the in vivo reduction of quinones, prostaglandins and other carbonyl-containing compounds including xenobiotics. In addition nitrogen-containing GSH adduct S-nitrosoglutathione (GSNO) is an efficient substrate of CBR1. CBR1 activity can be inhibited by various flavonoids including quercetin, rutin and semi-synthetic flavonoid monoHER (7-monohydroxyethylrutoside). Curcumin, a major component of the plant Curcuma longa, is a potent tight-binding inhibitor of CBR1. Absence of CBR1 promotes ovarian cancer growth and proliferation. CBR1 is responsible for conversion of cytotoxic daunorubicin to cardiotoxic daunorubicinol, thus reducing cytotoxicity of daunorubicin in primary acute myeloid leukemia cells. Glucocorticoid receptor binding to the CBR1 promoter stimulates CBR1 production in in human amnion fibroblasts. Presence of CBR1 converts prostaglandin E2 to prostaglandin F2α, which is involved in induction of human labor. NRF2 (Nuclear factor erythroid 2-related factor 2) is a transcriptional regulator of CBR1.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73872

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves