Skip to Content
Merck
All Photos(2)

Key Documents

AV43519

Sigma-Aldrich

Anti-M6PR antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-CD-MPR, Anti-FLJ32994, Anti-MPR46, Anti-Mannose-6-phosphate receptor (cation dependent), Anti-SMPR

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

28 kDa

species reactivity

mouse, human, rabbit, guinea pig, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... M6PR(4074)

General description

Mannose-6-phosphate receptor (cation dependent) (M6PR) is a receptor for mannose-6-phosphate groups on lysosomal enzymes. It is an integral membrane protein that belongs to type I membrane-spanning glycoproteins. M6PR protein exists as a homodimer and localizes in the trans-Golgi reticulum, endosomes, and the plasma membrane. M6PR gene is mapped to human chromosome 12p13.31.

Immunogen

Synthetic peptide directed towards the N terminal region of human M6PR

Biochem/physiol Actions

Mannose-6-phosphate receptor (cation dependent) (M6PR) aids in intracellular targeting of lysosomal enzymes. It mediates the export of newly synthesized acid hydrolases from the trans-Golgi network (TGN) to endosomes for their subsequent transfer to lysosomes. The presence of a cytoplasmic tail in M6PR protects it from lysosomal degradation. in vitro studies suggest that M6PR favors the secretion of pro-cathepsin D in breast cancer cells.

Sequence

Synthetic peptide located within the following region: RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Balraj Doray et al.
The Journal of biological chemistry, 277(21), 18477-18482 (2002-03-12)
The GGAs (Golgi-localizing, gamma-adaptin ear homology domain, ARF-binding) are a multidomain family of proteins implicated in protein trafficking between the Golgi and endosomes. Recent evidence has established that the cation-independent (CI) and cation-dependent (CD) mannose 6-phosphate receptors (MPRs) bind specifically
Pradipta Ghosh et al.
Nature reviews. Molecular cell biology, 4(3), 202-212 (2003-03-04)
The two mannose 6-phosphate (M6P) receptors were identified because of their ability to bind M6P-containing soluble acid hydrolases in the Golgi and transport them to the endosomal-lysosomal system. During the past decade, we have started to understand the structural features

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service