Skip to Content
Merck
All Photos(1)

Key Documents

AV33617

Sigma-Aldrich

Anti-CLDN9 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Claudin 9

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

24 kDa

species reactivity

mouse, horse, bovine, rat, guinea pig, human, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CLDN9(9080)

General description

Claudin-9, CLDN9, is a component of tight junction strands. CLDN9 is important for maintenance of sensory cells in the hearing organs. Mutations in the gene are associated with deafness.

Immunogen

Synthetic peptide directed towards the C terminal region of human CLDN9

Biochem/physiol Actions

CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Sequence

Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Xiaowei Zhang et al.
Diagnostic pathology, 13(1), 11-11 (2018-02-07)
Several studies have suggested that claudin proteins, which are the main components of tight junction structures, are related to the regulation of cell polarity and cell differentiation. To explore the expression profiles of the tight junction proteins claudin-2, - 5, - 8
Yoko Nakano et al.
PLoS genetics, 5(8), e1000610-e1000610 (2009-08-22)
Hereditary hearing loss is one of the most common birth defects, yet the majority of genes required for audition is thought to remain unidentified. Ethylnitrosourea (ENU)-mutagenesis has been a valuable approach for generating new animal models of deafness and discovering
Katharina Reinhard et al.
Science (New York, N.Y.), 367(6476), 446-453 (2020-01-04)
Chimeric antigen receptor (CAR)-T cells have shown efficacy in patients with B cell malignancies. Yet, their application for solid tumors has challenges that include limited cancer-specific targets and nonpersistence of adoptively transferred CAR-T cells. Here, we introduce the developmentally regulated
Hongyu Liu et al.
The Turkish journal of gastroenterology : the official journal of Turkish Society of Gastroenterology, 30(8), 722-731 (2019-08-17)
We have previously identified a tight junction protein claudin-9 (CLDN9) as an upregulated gene in hepatocellular carcinoma (HCC) through an immunohistochemistry analysis. Here, we explore its function and clinical relevance in human HCC. Stable transfection of the hepatocyte line HL7702
Christian O Chavarría-Velázquez et al.
Immunobiology, 223(1), 38-48 (2017-10-17)
Gastric carcinogenesis has been associated to H. pylori virulence factors that induce a chronic inflammation process. Lipopolysaccharides play a role in chronic inflammatory responses via TLR2- and TLR4-dependent signaling pathways. Similarly, cellular invasiveness, metastatic potential and prognosis are usually associated

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service