SAB5702457

Anti-Calcineurin A Antibody, clone 5I6H8, Rabbit Monoclonal

• Synonym(s): CALN, CALNA, CALNA1, CCN1, CNA1, PPP2B
• UNSPSC Code: 12352203
• NACRES: NA.46

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 5I6H8, monoclonal
• form: liquid
• mol wt: 59 kDa
• species reactivity: rat, human, rat
• concentration: 0.95 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: TLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
• UniProt accession no.: Q08209
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PPP3CA(5530)

Description

General description

Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+-mediated signals. Many of the substrates contain a PxIxIT motif and/or a LxVP motif. In response to increased Ca(2+ levels, dephosphorylates and activates phosphatase SSH1 which results in cofilin dephosphorylation. In response to increased Ca(2+ levels following mitochondrial depolarization, dephosphorylates DNM1L inducing DNM1L translocation to the mitochondrion. Dephosphorylates heat shock protein HSPB1 (By similarity. Dephosphorylates and activates transcription factor NFATC1. In response to increased Ca(2+ levels, regulates NFAT-mediated transcription probably by dephosphorylating NFAT and promoting its nuclear translocation. Dephosphorylates and inactivates transcription factor ELK1. Dephosphorylates DARPP32. May dephosphorylate CRTC2 at ′Ser-171′ resulting in CRTC2 dissociation from 14-3-3 proteins. Dephosphorylates transcription factor TFEB at ′Ser-211′ following Coxsackievirus B3 infection, promoting nuclear translocation.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 422-521 of human Calcineurin A (Q08209).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1