SAB1405227

Monoclonal Anti-POLD4 antibody produced in mouse

clone 2C11, purified immunoglobulin, buffered aqueous solution

• Synonym(s): POLDS, p12
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2C11, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~29.85 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: BC001334
• UniProt accession no.: Q9HCU8
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... POLD4(57804)

Description

General description

Mammalian DNA polymerase (Pol) δ contains four subunits, p125, p50, p68, and p12. DNA polymerase δ 4, accessory subunit (POLD4) is the smallest subunit of DNA polymerase δ. POLD4 gene is located on human chromosome 11q13.2.

Immunogen

POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL

Biochem/physiol Actions

Mammalian DNA polymerase (Pol) δ plays a key role in DNA replication. DNA polymerase δ 4, accessory subunit (POLD4) is involved in cell cycle progression. It helps to maintain the genomic stability of human cells. p12 is essential for the optimal activity of human Pol δ. p12 helps to stabilize Pol holoenzyme. Interaction of p12 with PCNA also aids in stabilizing the Pol-proliferating cell nuclear antigen (PCNA) complex. Lower expression of the POLD4 gene might participate in the progression of lung cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable