HPA023880
Anti-PAGE4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-G antigen family C member 1, Anti-GAGE-9, Anti-PAGE-1, Anti-PAGE-4, Anti-Prostate-associated gene 4 protein
Sign Into View Organizational & Contract Pricing
All Photos(3)
About This Item
UNSPSC Code:
12352203
Human Protein Atlas Number:
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:500- 1:1000
immunogen sequence
DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PAGE4(9506)
General description
Prostate-associated Gene 4 (PAGE4) is mapped to human chromosome Xp11.21. The gene codes for a prostate specific tumor antigen PAGE4. The protein belongs to the PAGE family, which is a subgroup of cancer/testis antigens (CTAs). PAGE4 is highly expressed in uterine and prostate cancer. It is also expressed in normal prostate, male and female reproductive tissues at a basal level.
Immunogen
G antigen family C member 1 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Prostate-associated Gene 4 (PAGE4) is an intrinsically disordered protein (IDP) with an anti-apoptotic function in prostate cancer (PCa) cells. The encoded protein acts as a stress-response protein by controlling the production of reactive oxygen species and preventing DNA damage. PAGE 4, on phosphorylation by HIPK1 (Homeodomain Interacting Protein Kinase 1), enhances c-jun trans-activation and thus plays a major role in stress response pathway in diseased cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST74320
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The cancer/testis antigen prostate-associated gene 4 (PAGE4) is a highly intrinsically disordered protein.
Zengg y
The Journal of Biological Chemistry, 286(16), 13985-13994 (2011)
PAGE4 is a cytoplasmic protein that is expressed in normal prostate and in prostate cancers.
Iavarone C
Molecular Cancer Therapeutics, 1(5), 329-335 (2002)
Steven M Mooney et al.
Biochemistry, 53(10), 1670-1679 (2014-02-25)
Prostate-associated gene 4 (PAGE4) is a cancer/testis antigen that is typically restricted to the testicular germ cells but is aberrantly expressed in cancer. Furthermore, PAGE4 is developmentally regulated with dynamic expression patterns in the developing prostate and is also a
Bryan Marsh et al.
eLife, 11 (2022-07-08)
The human placenta contains two specialized regions: the villous chorion where gases and nutrients are exchanged between maternal and fetal blood, and the smooth chorion (SC) which surrounds more than 70% of the developing fetus but whose cellular composition and
Effect of chloroquine on cultured fibroblasts: release of lysosomal hydrolases and inhibition of their uptake.
U N Wiesmann et al.
Biochemical and biophysical research communications, 66(4), 1338-1343 (1975-10-27)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service