Skip to Content
Merck
All Photos(6)

Key Documents

HPA008356

Sigma-Aldrich

Anti-RET antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

RET Antibody - Anti-RET antibody produced in rabbit, Ret Antibody, Anti-CDHF12, Anti-CDHR16, Anti-HSCR1, Anti-MEN2A, Anti-MEN2B, Anti-MTC1, Anti-PTC, Anti-RET51

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RET(5979)

General description

Proto-oncogene tyrosine-protein kinase receptor Ret (RET) is a receptor for the glial derived neurotrophic factor (GDNF) family of ligands. RET gene codes for the RET receptor protein. RET is predominantly found in the plasma membrane and the cytoplasm. It is mainly expressed in neural tissues, neuroendocrine cells, the digestive tract, adult kidneys, skin, and blood apparatus. RET has an extracellular region, a transmembrane region, and a cytoplasmic region. It also has four cadherin-like domains, a cysteine-rich domain, and calcium-binding sites. RET gene is located on human chromosome 10q11.21.

Immunogen

Proto-oncogene tyrosine-protein kinase receptor ret precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-RET antibody produced in rabbit has been used in immunohistochemical analysis (1:250).

Biochem/physiol Actions

Proto-oncogene tyrosine-protein kinase receptor Ret (RET) has four ligands-glial cell-derived neurotrophic factor (GDNF), neurturin, artemin and persephin. The binding of these ligands needs a GPI-anchored coreceptor (GFRα1-4). RET plays an important role in kidney and neural development, and maintains the number of somatotrophs at physiological levels. RET controls a complex network of signaling pathways in enteric nervous system progenitor cells during their development, survival, proliferation, differentiation, and migration. RET gene mutations are associated with medullary thyroid carcinoma (MTC), multiple endocrine neoplasia type 2A (MEN2A), familial medullary thyroid carcinomas (FMTC), multiple endocrine neoplasia type 2B (MEN2B), familial pheochromocytoma predisposition, Hirschsprung disease, congenital central hypoventilation syndrome, and renal hypodysplasia/aplasia 1. It possesses tyrosine kinase activity.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71122

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Montserrat Garcia-Lavandeira et al.
Frontiers of hormone research, 38, 127-138 (2010-07-10)
The RET receptor is a tyrosine kinase receptor implicated in kidney and neural development. In the adenopituitary RET and the co-receptor GFRa1 are expressed exclusively in the somatotrophs secreting GH. RET is implicated in a clever pathway to maintain at
Y Luo et al.
Oncogene, 32(16), 2037-2047 (2012-07-04)
Cancer arises as the consequence of mutations and epigenetic alterations that activate oncogenes and inactivate tumor suppressor genes. Through a genome-wide screen for methylated genes in colon neoplasms, we identified aberrantly methylated RET in colorectal cancer. RET, a transmembrane receptor
Snehal Dabir et al.
Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer, 9(9), 1316-1323 (2014-08-15)
There is growing interest in defining the somatic mutations associated with small-cell lung cancer (SCLC). Unfortunately, a serious blockade to genomic analyses of this disease is a limited access to tumors because surgery is rarely performed. We used our clinical/pathologic
Qiufu Ma
Neuron, 64(6), 773-776 (2010-01-13)
The rapidly adapting (RA) low-threshold mechanoreceptors respond to movement of the skin and vibration and are critical for the perception of texture and shape. In this issue of Neuron, two papers (Bourane et al. and Luo et al.) demonstrate that
RET (REarranged during Transfection)
Huret JL and Wan-Senon SYC
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2020)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service