Skip to Content
Merck
All Photos(6)

Key Documents

HPA003193

Sigma-Aldrich

Anti-SLC6A14 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Amino acid transporter ATB0+ antibody produced in rabbit, Anti-Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) antibody produced in rabbit, Anti-Solute carrier family 6 member 14 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43
conjugate:
unconjugated
application:
IHC
clone:
polyclonal
species reactivity:
human
citations:
8
technique(s):
immunohistochemistry: 1:50-1:200

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50-1:200

immunogen sequence

FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLC6A14(11254)

General description

SLC6A14 (solute carrier family 6 member 14) is the 14th member of the Na+ and Cl-dependent solute transport protein family. It acts as a dipolar and cationic amino acid transporter, and is a β-alanine carrier. It was initially isolated from human mammary gland. This gene is present in Xq22-24 human gene loci.

Immunogen

Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SLC6A14 antibody has been used in immunofluorescence and western blotting.
Anti-SLC6A14 antibody produced in rabbit has been used to stain tissue microarray (TMA) slides for tissue microarray screening and immunostaining.

Biochem/physiol Actions

SLC6A14 (solute carrier family 6 (amino acid transporter), member 14) is involved in the uptake and transportation of both neutral and cationic amino acids in a Na+/Cl--dependent manner. It also functions as a carrier of β-alanine. The protein may be involved in the absorption of essential nutrients and drugs. It may play a role in obesity and appetite control as it regulates tryptophan availability for serotonin synthesis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74345

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Transcriptomic and immunohistochemical profiling of SLC6A14 in pancreatic ductal adenocarcinoma
Penheiter AR, et al.
BioMed Research International (2015)
Alan R Penheiter et al.
BioMed research international, 2015, 593572-593572 (2015-06-25)
We used a target-centric strategy to identify transporter proteins upregulated in pancreatic ductal adenocarcinoma (PDAC) as potential targets for a functional imaging probe to complement existing anatomical imaging approaches. We performed transcriptomic profiling (microarray and RNASeq) on histologically confirmed primary
Catriona M H Anderson et al.
The Journal of physiology, 586(17), 4061-4067 (2008-07-05)
The beta-alanine carrier was characterized functionally in the 1960s to 1980s at the luminal surface of the ileal mucosal wall and is a Na(+)- and Cl(-)-dependent transporter of a number of essential and non-essential cationic and dipolar amino acids including
J L Sloan et al.
The Journal of biological chemistry, 274(34), 23740-23745 (1999-08-14)
A Na(+)-dependent neutral and cationic amino acid transport system (B(0+)) plays an important role in many cells and tissues; however, the molecular basis for this transport system is still unknown. To identify new transporters, the expressed sequence tag database was
Alexandra M Kraft et al.
American journal of physiology. Cell physiology, 319(5), C910-C921 (2020-09-10)
Some patients treated for ductal carcinoma in situ (DCIS) of the breast will experience cancer recurrences, whereas other patients will not. Unfortunately, current techniques cannot identify which preinvasive lesions will lead to recurrent cancer. Because the mechanism of cancer recurrence

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service