Skip to Content
Merck
All Photos(1)

Key Documents

AV09037

Sigma-Aldrich

Anti-SREBF2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-SREBP2, Anti-Sterol Regulatory element binding transcription factor 2

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

124 kDa

species reactivity

rat, guinea pig, dog, human, bovine, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SREBF2(6721)

Related Categories

Immunogen

Synthetic peptide directed towards the middle region of human SREBF2

Application

Anti- SREBF2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Biochem/physiol Actions

Sterol Regulatory Element-Binding Proteins (SREBPs) are transcription factors that are required for metabolic reprogramming and membrane synthesis in CD8+ T cells during the transition from quiescence to activation. SREBF2 is a transcriptional regulator of genes involved in cholesterol biosynthesis and lipid homeostasis.

Sequence

Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Guido T Bommer et al.
Cell metabolism, 13(3), 241-247 (2011-03-02)
The sterol regulatory element-binding factor-2 (SREBF2) gene is a bifunctional locus encoding SREBP-2, a well-known transcriptional regulator of genes involved in cholesterol biosynthesis, and microRNA-33a, which has recently been shown to reduce expression of proteins involved in export of cholesterol
Yoko Kidani et al.
Nature immunology, 14(5), 489-499 (2013-04-09)
Newly activated CD8(+) T cells reprogram their metabolism to meet the extraordinary biosynthetic demands of clonal expansion; however, the signals that mediate metabolic reprogramming remain poorly defined. Here we demonstrate an essential role for sterol regulatory element-binding proteins (SREBPs) in
Veerle W Daniëls et al.
PloS one, 9(9), e106913-e106913 (2014-09-13)
Increased lipogenesis is a hallmark of a wide variety of cancers and is under intense investigation as potential antineoplastic target. Although brisk lipogenesis is observed in the presence of exogenous lipids, evidence is mounting that these lipids may adversely affect

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service