WH0255631M7

Monoclonal Anti-COL24A1 antibody produced in mouse

clone 1D8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-collagen, type XXIV, alpha 1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1D8, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_152890
• UniProt accession no.: Q17RW2
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... COL24A1(255631)

Descripción

General description

Collagen type XXIV α 1 (COL24A1) is part of the fibril-forming family of collagen molecules and is expressed in bones.

Immunogen

COL24A1 (NP_690850, 1626 a.a. ~ 1714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL

Biochem/physiol Actions

Collagen type XXIV α 1 (COL24A1) takes part in modulating various processes in the cartilage and bone. It has been linked to head and neck squamous cell carcinoma.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)