WH0010902M1

Monoclonal Anti-BRD8 antibody produced in mouse

clone 3G8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-SMAP, Anti-SMAP2, Anti-bromodomain containing 8, Anti-p120
• MDL number: MFCD00284066
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3G8, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunofluorescence: suitable; indirect ELISA: suitable
• isotype: IgG2bκ
• GenBank accession no.: NM_139199
• UniProt accession no.: Q9H0E9
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BRD8(10902)

Descripción

General description

The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Three alternatively spliced transcript variants that encode distinct isoforms have been identified. (provided by RefSeq)

Immunogen

BRD8 (NP_631938, 33 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)