WH0003034M4

Monoclonal Anti-HAL antibody produced in mouse

clone 4F2, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-HIS, Anti-HSTD, Anti-histidine ammonia-lyase
• MDL number: MFCD02096540
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4F2, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_002108
• UniProt accession no.: P42357
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HAL(3034)

Descripción

General description

Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids (provided by RefSeq)

Immunogen

HAL (NP_002099, 558 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)