WH0002934M1

Monoclonal Anti-GSN antibody produced in mouse

clone 3G5, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-DKFZp313L0718, Anti-gelsolin (amyloidosis, Finnish type)
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3G5, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: BC026033
• UniProt accession no.: P06396
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GSN(2934)

Descripción

General description

Gelsolin (GSN) gene codes for gelsolin, a calcium-regulated actin regulatory protein. The GSN gene is mapped on human chromosome 9q33.2.

Immunogen

GSN (AAH26033, 673 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA

Biochem/physiol Actions

Gelsolin (GSN) protein plays a key role in inflammation, cell movement, apoptosis, and cancer progression. It can prevent the fibrillization of β-amyloid protein (Aβ) and defibrillate its produced fibrils. Mutations of the GSN gene can result in hereditary amyloidosis (HA). The deposition of amyloid fibrils formed from the gelsolin protein in many organs and tissues is characterized by familial amyloidosis, Finnish type (FAF), or AGel amyloidosis (AGel).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)