SAB5702413

Anti-Caldesmon Antibody, clone 6M5Q9, Rabbit Monoclonal

• Sinónimos: CDM, H-CAD, HCAD, L-CAD, LCAD, NAG22
• UNSPSC Code: 12352203

Propiedades

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 6M5Q9, monoclonal
• form: liquid
• mol wt: 80 kDa
• species reactivity: human
• concentration: 0.5 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: PTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV
• UniProt accession no.: Q05682
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CALD1(800)

Descripción

General description

This gene encodes a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids. This protein is a potent inhibitor of the actin-tropomyosin activated myosin MgATPase, and serves as a mediating factor for Ca(2+)-dependent inhibition of smooth muscle contraction. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 694-793 of human Caldesmon (Q05682).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1