SAB2108302

Anti-HNF1A antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 67kDa
• species reactivity: human, dog, mouse, guinea pig, horse, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunoblotting: suitable; immunohistochemistry: suitable
• NCBI accession no.: NM_000545
• UniProt accession no.: P20823
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HNF1A(6927)

Descripción

General description

Hepatocyte nuclear factor 1α (HNF1α) is a transcription factor that belongs to the liver enriched transcription factor family. It has a N-terminal dimerization domain (amino acids 1–32), a POU-homeobox DNA binding domain (amino acids 150-280) and a C-terminal transactivation domain (amino acids 281-631). HNF1A is located on human chromosome 12q24.

Immunogen

Synthetic peptide directed towards the N terminal region of human HNF1A

Biochem/physiol Actions

HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5′-GTTAATNATTAAC-3′.
Hepatocyte nuclear factor 1α (HNF1α) modulates hepatocyte functions. It plays an important role in the modulation of gene expression and replication of hepatitis B virus (HBV). HNF1α is involved in lipid metabolism, gluconeogenesis and deoxygenation of xenobiotics. It stimulates the expression of the preS1 mRNA to induce the production of LHBs (viral large surface protein). Mutations in hepatocyte nuclear factor-1A (HNF1A) results in maturity-onset diabetes of the young type 3 (MODY3).

Sequence

Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable