SAB2105642

Anti-OSBPL1A antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FLJ10217, Anti-ORP-1, Anti-ORP1, Anti-OSBPL1B
• UNSPSC Code: 12352203
• NACRES: NA.41
• clone: polyclonal
• application: WB
• species reactivity: guinea pig, rat, rabbit, dog, mouse, bovine, horse, human
• technique(s): western blot: suitable

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 108 kDa
• species reactivity: guinea pig, rat, rabbit, dog, mouse, bovine, horse, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_080597
• UniProt accession no.: Q9BXW6
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... OSBPL1A(114876)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human OSBPL1A

Biochem/physiol Actions

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist; they encode different isoforms.

Sequence

Synthetic peptide located within the following region: EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable