SAB2101256

Anti-KIF12 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Kinesin family member 12, Anti-RP11-56P10.3
• UNSPSC Code: 12352203
• NACRES: NA.41
• clone: polyclonal
• application: WB
• species reactivity: dog, rabbit, human, bovine, guinea pig, rat
• technique(s): western blot: suitable

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 56 kDa
• species reactivity: dog, rabbit, human, bovine, guinea pig, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: B1ALC3
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... KIF12(113220)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human KIF12

Biochem/physiol Actions

KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors (see MIM 148760) that play important roles in intracellular transport and cell division (Nakagawa et al., 1997 [PubMed 9275178]).[supplied by OMIM].

Sequence

Synthetic peptide located within the following region: SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable