SAB2100965

Anti-GPSM2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-G-protein signaling modulator 2 (AGS3-like, C. elegans), Anti-LGN, Anti-Pins
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 76 kDa
• species reactivity: human, bovine, rabbit, horse, rat, dog, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunofluorescence: suitable; immunohistochemistry: suitable; western blot: suitable
• UniProt accession no.: P81274
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... GPSM2(29899)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human GPSM2

Biochem/physiol Actions

Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002 [PubMed 11832491]).[supplied by OMIM].

Sequence

Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable