SAB1402084

Monoclonal Anti-SLC13A5 antibody produced in mouse

clone 2G4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: DKFZp686E17257, MGC138356, NACT
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2G4, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): capture ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_177550
• UniProt accession no.: Q86YT5
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLC13A5(284111)

Descripción

General description

The solute carrier family 13 member 5 (SLC13A5) gene is mapped to human chromosome 17p13.1. It is highly expressed in the plasma membrane of hepatocytes and is also expressed in the cells of testis and brain.

Immunogen

SLC13A5 (NP_808218, 152 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK

Biochem/physiol Actions

SLC13A5 (solute carrier family 13 member 5) is a sodium-coupled citrate transporter. Its function involves the transportation of citrate from the bloodstream into the liver. The expression of the gene is found to be increased in obesity and non-alcoholic fatty liver disease. Downregulation of SLC13A5 promotes AMPK (adenosine monophosphate-activated protein kinase) activation and inhibits ACLY (ATP citrate lyase) expression. SLC13A5 is thus found to regulate homeostasis of energy and lipid in liver cancer, as the gene is associated with synthesis of fatty acids and cholesterol. Mutation in the SLC13A5 gene leads to early occurrence of epilepsy, developmental delay and tooth dysplasia in children.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable