Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

HPA025073

Sigma-Aldrich

Anti-SPRTN antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-C1orf124, Anti-Zinc finger RAD18 domain-containing protein C1orf124

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL

immunogen sequence

SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDT

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

C1orf124/Spartan, a protein that contains a PCNA-interacting peptide motif, called a PIP box, and a UBZ4 ubiquitin-binding domain, is involved in Rad18-mediated Proliferating Cell Nuclear Antigen (PCNA) ubiquitination and the regulation of DNA damage tolerance via post-replication repair (PRR). It promotes a feed-forward loop to enhance PCNA ubiquitylation and translesion DNA synthesis. Spartan plays an important role in preventing mutations associated with replication of damaged DNA.
Rabbit polyclonal Anti-C1orf124 antibody reacts with human zinc finger RAD18 domain-containing protein C1orf124/spartan.

Immunogen

Zinc finger RAD18 domain-containing protein C1orf124 recombinant protein epitope signature tag (PrEST)

Application

Rabbit polyclonal Anti-C1orf124 antibody is used to tag zinc finger RAD18 domain-containing protein/Spartan for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques such as ELISA, immunoblotting, and immunoprecipitation. It is used as a probe to determine the presence and roles of zinc finger RAD18 domain-containing protein/Spartan in the regulation of DNA damage tolerance via post-replication repair (PRR).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76479

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Anna Mosbech et al.
Nature structural & molecular biology, 19(11), 1084-1092 (2012-10-09)
Ubiquitin-mediated processes orchestrate critical DNA-damage signaling and repair pathways. We identify human DVC1 (C1orf124; Spartan) as a cell cycle-regulated anaphase-promoting complex (APC) substrate that accumulates at stalled replication forks. DVC1 recruitment to sites of replication stress requires its ubiquitin-binding UBZ
Jaime Lopez-Mosqueda et al.
eLife, 5 (2016-11-18)
Ruijs-Aalfs syndrome is a segmental progeroid syndrome resulting from mutations in the SPRTN gene. Cells derived from patients with SPRTN mutations elicit genomic instability and people afflicted with this syndrome developed hepatocellular carcinoma. Here we describe the molecular mechanism by
Charlotte Stadler et al.
Nature methods, 10(4), 315-323 (2013-02-26)
Imaging techniques such as immunofluorescence (IF) and the expression of fluorescent protein (FP) fusions are widely used to investigate the subcellular distribution of proteins. Here we report a systematic analysis of >500 human proteins comparing the localizations obtained in live
Hanna-Mari Koskimaa et al.
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology, 19(8), 2003-2012 (2010-07-22)
Human papillomavirus can induce a stepwise progression of precursor lesions to carcinoma. Sensitive and specific molecular markers are needed to identify the cervical lesions (CIN) at risk for this progression. hTERT activation could be one indicator of a point of

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico