Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

HPA005661

Sigma-Aldrich

Anti-ADAMTS5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-A disintegrin and metalloproteinase with thrombospondin motifs 5 antibody produced in rabbit, Anti-ADAM-TS 11 antibody produced in rabbit, Anti-ADAM-TS 5 antibody produced in rabbit, Anti-ADAM-TS5 antibody produced in rabbit, Anti-ADAMTS-5 precursor antibody produced in rabbit, Anti-ADMP-2 antibody produced in rabbit, Anti-Aggrecanase-2 antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA005661
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS

UniProt accession no.

Q9UNA0

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ADAMTS5(11096)

Categorías relacionadas

General description

ADAM metallopeptidase with thrombospondin motifs 5 (ADAMTS5) belongs to the ADAM protein family. It has an ADAM-like protease domain, a disintegrin-like domain and a cysteine-rich domain. ADAMTS5 lacks a transmembrane domain and is thus secreted into the extracellular matrix.

Immunogen

A disintegrin and metalloproteinase with thrombospondin motifs 5 precursor (ADAMTS-5) (ADAM-TS5) (Aggrecanase-2) (ADMP-2) (A disintegrin and metalloproteinase with thrombospondin motifs 11) (ADAMTS-11)

Application

Anti-ADAMTS5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

ADAM metallopeptidase with thrombospondin motifs 5 (ADAMTS5) is involved in aggrecan, brevican and α2-macroglobulin degradation. It is one of the most important extra cellular matrix (ECM) degrading enzymes and functions in tissue degradation, remodeling and cell infiltration. ADAMTS5 cleaves cartilage aggrecan at the Glu (373)-Ala (374) bond and also in the region spanning residues Gly (1481) and Glu (1667), which represents its unique cleavage site.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85176

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Tao Wang et al.
International journal of molecular medicine, 44(2), 630-642 (2019-06-15)
Osteoarthritis (OA) is a common and troublesome disease among the elderly, and is characterized by extracellular matrix (ECM) degradation. The function of the long non‑coding RNA X‑inactive‑specific transcript (XIST) and its working mechanism in ECM degradation remains unclear. In the
Lingqiang Chen et al.
Journal of cellular and molecular medicine, 21(12), 3347-3359 (2017-06-14)
This study was aimed to explore the role of miR-29b-3p and PGRN in chondrocyte apoptosis and the initiation and progress of osteoarthritis (OA). Both miR-29b-3p and PGRN were up-regulated in cartilage tissue from patients with OA. Transfection of miR-29b-3p mimic
Xing Li et al.
Molecular medicine reports, 18(1), 541-549 (2018-05-12)
The aim of the present study was to investigate the role of microRNA (miR)‑27a‑3p in osteoarthritis (OA). Reverse transcription‑quantitative polymerase chain reaction and western blotting were performed to determine the expression of miR‑27a‑3p and aggrecanase‑2 (ADAMTS5) in cartilage tissues from
Priscilla B Pail et al.
International immunopharmacology, 72, 62-73 (2019-04-09)
This study evaluated the role of kinin B1 and B2 receptors in the pre-clinical mouse model of oxazolone-induced atopic dermatitis. The B1 R715 or B2 HOE140 receptor antagonists were dosed at different schemes of treatment. After assessment of clinical lesion
Kevin Ngo et al.
Spine, 42(20), 1521-1528 (2017-06-02)
ADAMTS5-deficient and wild type (WT) mice were chronically exposed to tobacco smoke to investigate effects on intervertebral disc degeneration (IDD). The aim of this study was to demonstrate a role for ADAMTS5 in mediating tobacco smoking-induced IDD. We previously demonstrated
Ver todos los artículos relacionados

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico