Saltar al contenido
Merck
Todas las fotos(3)

Key Documents

AV100841

Sigma-Aldrich

Anti-IRF8 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Interferon regulatory factor 8

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

48 kDa

species reactivity

human, dog, rat, horse, rabbit, guinea pig, mouse, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IRF8(3394)

General description

Interferon regulatory factors are transcription factors that regulate the expression of interferon system. The activity of IRF-8 has been implicated in vascular diseases.

Immunogen

Synthetic peptide directed towards the N terminal region of human IRF8

Application

Anti-IRF8 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Biochem/physiol Actions

IRF-8 regulates the activity of myocardin and modulates the phenotype of smooth muscle cells. It regulates the development and function of T cells, B cells and macrophages. IRF-8 induces the production of type 1 interferons in dendritic cells.

Sequence

Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Runqing Lu
Trends in immunology, 29(10), 487-492 (2008-09-09)
Interferon regulatory factor 4 (IRF4) and 8 are members of the interferon regulatory factor family of transcription factors and have been shown to be essential for the development and function of T cells, macrophages and dendritic cells. A series of
Prafullakumar Tailor et al.
Immunity, 27(2), 228-239 (2007-08-19)
Dendritic cells (DCs) produce type I interferons (IFNs) in greater amounts than other cells, but the mechanisms remain elusive. Here we studied the role of a transcription factor, IRF8, in DC induction of type I IFNs. Upon newcastle disease virus
Shu-Min Zhang et al.
Molecular and cellular biology, 34(3), 400-414 (2013-11-20)
Interferon regulatory factor 8 (IRF8), a member of the IRF transcription factor family, was recently implicated in vascular diseases. In the present study, using the mouse left carotid artery wire injury model, we unexpectedly observed that the expression of IRF8

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico