Saltar al contenido
Merck
Todas las fotos(2)

Key Documents

Otros documentos

860381P

Avanti

14:0 PG-d54

Avanti Polar Lipids 860381P, powder

Sinónimos:

1,2-dimyristoyl-d54-sn-glycero-3-[phospho-rac-(1-glycerol)] (sodium salt)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Fórmula empírica (notación de Hill):
C34H12O10PNaD54
Número de CAS:
326495-45-8
Peso molecular:
743.18
UNSPSC Code:
12352100
NACRES:
NA.25

assay

>99% (TLC)

form

powder

packaging

pkg of 1 × 10 mg (860381P-10mg)
pkg of 1 × 100 mg (860381P-100mg)

manufacturer/tradename

Avanti Polar Lipids 860381P

shipped in

dry ice

storage temp.

−20°C

SMILES string

[H][C@@](COP([O-])(OCC(O)CO)=O)(OC(C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])[2H])=O)COC(C([2H])([2H])C([2H])([2H])C([2H])([2H])

Categorías relacionadas

General description

14:0 PG-d54 is a deuterated phosphoglycerol (PG) wherein 54 protons of dimyristoyl are replaced by deuterium.
Deuterated fatty acids experience exchange of the deuteriums on the alpha carbon to the carbonyl, i.e., C2 position, and will therefore be a mixture of compounds that are fully deuterated and partially deuterated at that position.

Application

14:0 PG-d54 may be used to study the unspecific interaction of a phospholipid membrane with endotoxins.

Packaging

5 mL Amber Glass Screw Cap Vial (860381P-100mg)
5 mL Amber Glass Screw Cap Vial (860381P-10mg)

Legal Information

Avanti Research is a trademark of Avanti Polar Lipids, LLC

Storage Class

11 - Combustible Solids

wgk_germany

WGK 3

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Lipopolysaccharide-binding protein-mediated interaction of lipid A from different origin with phospholipid membranes Invited Lecture
Gutsmann T, et al.
Physical Chemistry Chemical Physics, 2(20), 4521-4528 (2000)
Randi Nordström et al.
Journal of colloid and interface science, 562, 322-332 (2019-12-20)
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta
Chris Miranda et al.
Langmuir : the ACS journal of surfaces and colloids, 34(39), 11759-11771 (2018-09-11)
SP-B63-78, a lung surfactant protein fragment, and magainin 2, an antimicrobial peptide, are amphipathic peptides with the same overall charge but different biological functions. Deuterium nuclear magnetic resonance has been used to compare the interactions of these peptides with dispersions
Nicole Harmouche et al.
Biophysical journal, 115(6), 1033-1044 (2018-09-10)
A synergistic enhancement of activities has been described for the amphipathic cationic antimicrobial peptides magainin 2 and PGLa when tested in antimicrobial assays or in biophysical experiments using model membranes. In the presence of magainin 2, PGLa changes from an

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico