SAB2102610

Anti-TUT1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FLJ21850, Anti-FLJ22267, Anti-FLJ22347, Anti-MGC131987, Anti-Terminal uridylyl transferase 1, U6 snRNA-specific
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 94 kDa
• species reactivity: guinea pig, bovine, human, horse, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q9H6E5
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TUT1(64852)

Descripción

General description

The previously assigned protein identifier A8K995 has been merged into Q9H6E5. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human TUT1

Biochem/physiol Actions

TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3′ end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation.TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 [PubMed 16790842]).[supplied by OMIM].

Sequence

Synthetic peptide located within the following region: CDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable