All Photos(4)



Anti-GJA1 antibody produced in rabbit

affinity isolated antibody

Anti-CX43, Anti-DFNB38, Anti-GJAL, Anti-Gap junction protein, α 1, 43kDa, Anti-ODDD
MDL number:

biological source


Quality Level



antibody form

affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution

mol wt

43 kDa

species reactivity

horse, rabbit, guinea pig, dog, human


0.5 mg - 1 mg/mL


western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.


Gene Information

human ... GJA1(2697)


Synthetic peptide directed towards the middle region of human GJA1

Biochem/physiol Actions

Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. Connexin 43 is targeted by several protein kinases that regulate myocardial cell-cell coupling. A related intron-less connexin 43 pseudogene, GJA1P, has been mapped to chromosome 5. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia and heart malformations. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


Synthetic peptide located within the following region: GSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids



Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service