MilliporeSigma
All Photos(4)

AV37986

Sigma-Aldrich

Anti-SOX9 antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal), Anti-CMD1, Anti-CMPD1, Anti-SRA1

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

56 kDa

species reactivity

rat, horse, human, pig, dog, mouse, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

flow cytometry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... SOX9(6662)

General description

SRγ (sex determining region γ) (SOX) are HMG box containing transcription factors that bind to the minor groove of DNA. Sox proteins family members regulate a variety of aspects of development. SRγ (sex determining region γ)-box 9 (SOX9, CMD1, CMPD1, SRA1, SRγ) is a master regulator of chondrocyte differentiation and chondrogenesis, which results in the formation of cartilage.

Specificity

Anti-SOX9 polyclonal antibody reacts with human, mouse, rat, canine, chicken, and pig SRγ (sex determining region γ)-box 9 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human SOX9

Application

Anti-SOX9 polyclonal antibody is used to tag SRγ (sex determining region γ)-box 9 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of SRγ (sex determining region γ)-box 9 in chondrocyte differentiation and cartilage formation.

Biochem/physiol Actions

SOX9 recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service