Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

SAB2104963

Sigma-Aldrich

Anti-FAM135B antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-C8ORFK32, Anti-MGC126009, Anti-MGC126010, Anti-MGC33221

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

156 kDa

species reactivity

human, guinea pig, bovine, mouse, horse, dog, rabbit, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... FAM135B(51059)

General description

FAM135B (family with sequence similarity 135 member B) gene is localized to human chromosome 8. This gene shows wide level of tissue expression, including heart and brain.

Immunogen

Synthetic peptide directed towards the middle region of human FAM135B

Biochem/physiol Actions

FAM135B (family with sequence similarity 135 member B) is a new oncogene that facilitates malignancy in SCC (squamous cell carcinoma) cells and ESCC (esophageal SCC). This gene participates in cell activity and signaling, including in brain. Polymorphism in this gene is linked with extrapulmonary tuberculosis.

Sequence

Synthetic peptide located within the following region: TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jalil Pirayesh Islamian et al.
Cancer biology & medicine, 11(2), 78-85 (2014-07-11)
Esophageal cancer has been reported as the ninth most common malignancy and ranks as the sixth most frequent cause of death worldwide. Esophageal cancer treatment involves surgery, chemotherapy, radiation therapy, or combination therapy. Novel strategies are needed to boost the
Noffisat O Oki et al.
BMC research notes, 4, 28-28 (2011-02-02)
Approximately 5-10% of persons infected with M. tuberculosis develop tuberculosis, but the factors associated with disease progression are incompletely understood. Both linkage and association studies have identified human genetic variants associated with susceptibility to pulmonary tuberculosis, but few genetic studies
Abbes Belkhiri et al.
Oncotarget, 6(3), 1348-1358 (2015-01-17)
Esophageal cancer, comprising squamous carcinoma and adenocarcinoma, is a leading cause of cancer-related death in the world. Notably, the incidence of esophageal adenocarcinoma has increased at an alarming rate in the Western world. Unfortunately, the standard first-line chemo-radiotherapeutic approaches are

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service