Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

WH0284312M2

Sigma-Aldrich

Monoclonal Anti-ZSCAN1 antibody produced in mouse

clone 7C1, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-FLJ33779, Anti-MGC104472, Anti-MZF1, Anti-zinc finger and SCAN domain containing 1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

7C1, monoclonal

Postać

buffered aqueous solution

reaktywność gatunkowa

human

metody

indirect ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG1κ

numer dostępu GenBank

NM_182572

numer dostępu UniProt

Q8NBB4

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... ZSCAN1(284312)

Powiązane kategorie

Opis ogólny

Zinc finger and SCAN domain containing 1 (ZSCAN1) belongs to the Krüppel family of zinc finger nucleases.

Immunogen

ZSCAN1 (NP_872378, 315 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
REEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHTAHGH

Działania biochem./fizjol.

Zinc finger and SCAN domain containing 1 (ZSCAN1) modulates the transcription and expression of genes which take part in signaling cascades.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

nwg

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Rui Lin et al.
PloS one, 8(3), e56379-e56379 (2013-03-09)
Genome-wide association studies (GWAS) have identified around 60 common variants associated with multiple sclerosis (MS), but these loci only explain a fraction of the heritability of MS. Some missing heritability may be caused by rare variants that have been suggested
Ling Li et al.
PloS one, 9(6), e98653-e98653 (2014-06-05)
Transcriptional regulatory network (TRN) is used to study conditional regulatory relationships between transcriptional factors and genes. However few studies have tried to integrate genomic variation information such as copy number variation (CNV) with TRN to find causal disturbances in a
Joanna Przybyl et al.
Sarcoma, 2012, 249219-249219 (2012-05-03)
Synovial sarcoma (SS), an aggressive type of soft tissue tumor, occurs mostly in adolescents and young adults. The origin and molecular mechanism of the development of SS remain only partially known. Over 90% of SS cases are characterized by the
Wei Jiang et al.
Experimental and therapeutic medicine, 19(4), 2449-2456 (2020-04-08)
Overuse and misuse of antibiotics leads to antibiotic resistance which has become a significant public health concern. Klebsiella pneumoniae is the most common pathogenic bacteria underlying nosocomial infections due to the expression of virulence factors and occurrence of antibiotic resistance.

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej