SAB5702755

Anti-alpha 1 Spectrin Antibody, clone 1U5K4, Rabbit Monoclonal

• Synonim(y): EL2, HPP, HS3, SPH3, SPTA
• Kod UNSPSC: 12352203
• NACRES: NA.46

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 1U5K4, monoclonal
• Postać: liquid
• masa cząsteczkowa: 280 kDa
• reaktywność gatunkowa: rat, rat, human
• stężenie: 1.05 mg/mL
• metody: western blot: 1:500 - 1:2000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: LRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG
• numer dostępu UniProt: P02549
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SPTA1(6708)

Opis

Opis ogólny

Spectrin is an actin crosslinking and molecular scaffold protein that links the plasma membrane to the actin cytoskeleton, and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. It is a tetramer made up of alpha-beta dimers linked in a head-to-head arrangement. This gene is one member of a family of alpha-spectrin genes. The encoded protein is primarily composed of 22 spectrin repeats which are involved in dimer formation. It forms weaker tetramer interactions than non-erythrocytic alpha spectrin, which may increase the plasma membrane elasticity and deformability of red blood cells. Mutations in this gene result in a variety of hereditary red blood cell disorders, including elliptocytosis type 2, pyropoikilocytosis, and spherocytic hemolytic anemia. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 2300-2400 of human alpha 1 Spectrin (P02549).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1