MSST0017

SILu^™Prot IL6 Interleukin 6 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C- and ¹⁵N-labeled

• Synonim(y): B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, IL-6, Interferon beta-2 (IFN-beta-2)
• Kod UNSPSC: 23201100
• NACRES: NA.12

Właściwości

• pochodzenie biologiczne: human
• Poziom jakości: 200
• rekombinowane: expressed in HEK 293 cells
• Próba: 98% (SDS-PAGE)
• Postać: lyophilized powder
• siła działania: ≥98% Heavy amino acids incorporation efficiency by MS
• metody: mass spectrometry (MS): suitable
• przydatność: suitable for mass spectrometry (standard)
• numer dostępu UniProt: P05231
• temp. przechowywania: −20°C
• informacje o genach: human ... IL6(3569)

Opis

Opis ogólny

SILu^™ Prot IL-6 is a recombinant, stable isotope-labeled human IL-6 which incorporates [¹³C₆, ¹⁵N₄]-Arginine and ^[13C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IL-6 in mass-spectrometry. SILu^™ Prot IL-6 is a monomer of 183 amino acids, with a molecular weight of ~21 kDa.

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Działania biochem./fizjol.

IL-6 is an abundant cytokine, which is crucial for leukocyte and endothelial cell activation. IL-6 is one of the major cytokines that are implicated clinically as biomarkers in ACS (Acute Coronary Syndrome). Its pathophysiological contribution to ACS is the induction of acute-phase response. Patients with ACS have increased circulating levels of IL-6 compared with those patients who have stable angina. Among patients with unstable angina, an increase in IL-6 levels that occurred 48 hours after admission compared with the admission value was associated with the combined end point of death, myocardial infarction (MI), or refractory angina. High levels of IL-6 are also related to cardiovascular disease, heart attack, and stroke.

Sekwencja

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Postać fizyczna

Supplied as a lyophilized powder containing phosphate buffered saline.

Informacje prawne

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 11 - Combustible Solids
• Klasa zagrożenia wodnego (WGK): WGK 2
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable