Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Dokumenty

HPA042257

Sigma-Aldrich

Anti-RP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

MAPRE2, Microtubule-associated protein RP/EB family member 2, Anti-Dcdc4a, Anti-Retinitis pigmentosa 1 (autosomal dominant)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Numer MDL:
MFCD01633308
Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
HPA042257
NACRES:
NA.43

pochodzenie biologiczne

rabbit

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Postać

buffered aqueous glycerol solution

reaktywność gatunkowa

human

metody

immunohistochemistry: 1:500-1:1000

sekwencja immunogenna

VTCSPCEMCTVNKAYSPKETCNPSDTFFPSDGYGVDQTSMNKACFLGEVCSLTDTVFSDKACAQKENHTYEGACPIDETYVPVNVCNTIDFLNSKENTYTDNLDSTEELERGDDIQKDLNILTDPEYKNGFNTLVSHQNVSNLSSCG

numer dostępu UniProt

P56715

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... RP1(6101)

Opis ogólny

Retinitis pigmentosa-1 (RP1) is a photoreceptor microtubule-associated protein. RP1 belongs to end binding protein 1(EB1) protein family, which interacts with adenomatous polyposis coli (APC). RP1 is located on human chromosome 8.

Immunogen

retinitis pigmentosa 1 (autosomal dominant) recombinant protein epitope signature tag (PrEST)

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Działania biochem./fizjol.

Retinitis pigmentosa-1 (RP1) regulates microtubule formation. Casein kinase II (CK2) a protein kinase when phosphorylates RP1 at Ser(236) aids cell adhesion.RP1 contributes to maintain the architecture of photoreceptor outer segments. Dysfunctioning of RP1 leads to neurodegenerative diseases. Mutations in RP1 gene is known to cause retinitis pigmentosa. Certain regions of RP1 may also cause autosomal recessive rod-cone dystrophy.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST71374

Postać fizyczna

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Targeted next generation sequencing identifies novel mutations in RP1 as a relatively common cause of autosomal recessive rod-cone dystrophy
El Shamie, et al.
BioMed Research International, 2015 (2015)
The retinitis pigmentosa 1 protein is a photoreceptor microtubule-associated protein
Liu, Qin, et al.
The Journal of Neuroscience, 24(29), 6427-6436 (2004)
Linkage mapping of autosomal dominant retinitis pigmentosa (RP1) to the pericentric region of human chromosome 8
Blanton,, et al.
Genomics, 11(4), 857-869 (1991)
RP1 is a phosphorylation target of CK2 and is involved in cell adhesion
Stenner,, et al.
PLoS ONE, 8(7), e67595-e67595 (2013)
Molecular basis for photoreceptor outer segment architecture
Goldberg,, et al.
Progress in Retinal and Eye Research, 55, 52-81 (2016)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej