Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

AV50512

Sigma-Aldrich

Anti-ING1 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Inhibitor of growth family, member 1, Anti-p24ING1c, Anti-p33, Anti-p33ING1, Anti-p33ING1b, Anti-p47, Anti-p47ING1a

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

32 kDa

reaktywność gatunkowa

dog, human, guinea pig, bovine, rat, mouse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_005528

numer dostępu UniProt

Q5T9H0

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... ING1(3621)

Immunogen

Synthetic peptide directed towards the C terminal region of human ING1

Zastosowanie

Anti-ING1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Działania biochem./fizjol.

Inhibitor of growth family, member 1 (ING1; p47; p33) is a nuclear protein with tumor suppressor activity. It interacts with p53, participates in p53-mediated signaling and regulates cell growth and apoptosis. However, ING1 also acts independent of p53; translocates to mitochondria and induces apoptosis by altering mitochondrial membrane potential.

Sekwencja

Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Julieta M Ceruti et al.
Molecular and cellular biochemistry, 378(1-2), 117-126 (2013-03-06)
ING proteins are tumor suppressors involved in the regulation of gene transcription, cell cycle arrest, apoptosis, and senescence. Here, we show that ING1b expression is upregulated by several DNA-damaging agents, in a p53-independent manner. ING1b stimulates DNA repair of a
P Bose et al.
Cell death & disease, 4, e788-e788 (2013-09-07)
The ING family of tumor suppressors acts as readers and writers of the histone epigenetic code, affecting DNA repair, chromatin remodeling, cellular senescence, cell cycle regulation and apoptosis. The best characterized member of the ING family, ING1,interacts with the proliferating

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej