Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV47036

Sigma-Aldrich

Anti-TOR1B antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-DQ1, Anti-MGC4386, Anti-Torsin family 1, member B (torsin B)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

38 kDa

reaktywność gatunkowa

rat, mouse, human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_055321

numer dostępu UniProt

O14657

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... TOR1B(27348)

Immunogen

Synthetic peptide directed towards the C terminal region of human TOR1B

Zastosowanie

Anti-TOR1B antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

Działania biochem./fizjol.

TOR1B [Torsin family 1, member B (torsin B)] gene encodes a 336 amino acid containing protein, predominantly expressed in the developing human brain and belonging to ClpA/ClpB family and torsin subfamily. It plays a pivotal role in postnatal developmental events and is crucial for proper neurological development. TOR1B may also facilitate as a molecular chaperone assisting in the proper folding of secreted and membrane proteins. Mutation in TOR1B gene results in torsion dystonia, an autosomal dominant neurological disorder.

Sekwencja

Synthetic peptide located within the following region: VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

E Bahn et al.
Brain research, 1116(1), 112-119 (2006-08-30)
Familial, early onset, generalized torsion dystonia is the most common and severe primary dystonia. The majority of cases are caused by a 3-bp deletion (GAG) in the coding region of the DYT1 (TOR1A) gene. The cellular and regional distribution of
C Kamm et al.
Neurology, 67(10), 1857-1859 (2006-11-30)
Recently, association of a TOR1A(DYT1)/TOR1B risk haplotype with common forms of idiopathic dystonia has been reported in the Icelandic population. Here we report a strong association of two single nucleotide polymorphisms within or in close proximity to the TOR1A 3'UTR
Anju Vasudevan et al.
Brain research, 1073-1074, 139-145 (2006-02-07)
Early onset torsion dystonia is characterized by involuntary movements and distorted postures and is usually caused by a 3-bp (GAG) deletion in the DYT1 (TOR1A) gene. DYT1 codes for torsinA, a member of the AAA+ family of proteins, implicated in

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej