AV43931

Anti-SLC39A6 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-LIV-1, Anti-Solute carrier family 39 (Zinc transporter), member 6
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 48 kDa
• reaktywność gatunkowa: human, mouse, rat, sheep, horse, dog, bovine, rabbit
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_036451
• numer dostępu UniProt: Q13433-2
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SLC39A6(25800)

Opis

Opis ogólny

Solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 (SLC39A6, LIV1, ZIP6) is a mediator of zinc (Zn²⁺) transport and intracellular zinc homeostasis. SLC39A6/LIV1 is involves in important processes such as epithelial-to-mesenchymal transition (EMT) in human pancreatic, breast, and prostate cancer cells. SLC39A6/LIV1 has been shown to be a critical mediator responsible for HDACi-induced apoptosis.

Specyficzność

Anti-SLC39A6 polyclonal antibody reacts with bovine, canine, human, mouse, and rat solute carrier family 39 (Zinc transporter), member 6 proteins.

Immunogen

Synthetic peptide directed towards the middle region of human SLC39A6

Zastosowanie

Anti-SLC39A6 polyclonal antibody is used to tag solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 in intracellular zinc homeostasis, epithelial-to-mesenchymal transition (EMT) in cancer cells, and in HDACi-induced apoptosis.

Działania biochem./fizjol.

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.

Sekwencja

Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable